Thraustochytrium mitochondrial code

The Thraustochytrium mitochondrial code (translation table 23) is a genetic code found in the mitochondria of labyrinthulid Thraustochytrium aureum.[1] The mitochondrial genome was sequenced by the Organelle Genome Megasequencing Program.

Code

   AAs = FF*LSSSSYY**CC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = --------------------------------M--M---------------M------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

It is the similar to the bacterial code (translation table 11) but it contains an additional stop codon (TTA) and also has a different set of start codons.

DNA codonsRNA codonsThis code (23)Standard code (1)
TTAUUASTOP = Ter (*)Leu (L)

Systematic range and comments

  • Mitochondria of Thraustochytrium aureum.
gollark: This is annoying. I can't run lolcrypt on my phone.
gollark: I think I should be first.
gollark: Wait, is it really valid to say that you met *yourself* though?
gollark: Unfortunately, not following the rules is against the rules.
gollark: Specific required actions based in THE RULES prohibit such actions whilst using Switchcraft or associated systems.

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [2]

  1. Wideman, Jeremy G.; Monier, Adam; Rodríguez-Martínez, Raquel; Leonard, Guy; Cook, Emily; Poirier, Camille; Maguire, Finlay; Milner, David S.; Irwin, Nicholas A. T.; Moore, Karen; Santoro, Alyson E. (25 November 2019). "Unexpected mitochondrial genome diversity revealed by targeted single-cell genomics of heterotrophic flagellated protists". Nature Microbiology. 5 (1): 154–165. doi:10.1038/s41564-019-0605-4. ISSN 2058-5276.
  2. Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 11 August 2016.


This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.