Blastocrithidia nuclear code

The Blastocrithidia nuclear code (translation table 31) is a genetic code used by the nuclear genome of the trypanosomatid genus Blastocrithidia.[1]

The code (31)

   AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = ----------**-----------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V).

Differences from the standard code

DNA codons RNA codons This code (31) Standard code (1)
TAA UAA Ter (*) or Glu (E) Ter (*)
TAG UAG Ter (*) or Glu (E) Ter (*)
TGA UGA Trp (W) Ter (*)
gollark: Just allocate more stacks on the stack.
gollark: ddg! cryoapioform
gollark: I do not think that is valid Python.
gollark: Close THESE brackets, apioid.
gollark: ((())((()()))))()((())())(()))(())())())(()((()))((()())))))((((((((((()(((((((()))(()(()()(()))))((

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [2]

  1. Záhonová, Kristína; Kostygov, Alexei Y.; Ševčíková, Tereza; Yurchenko, Vyacheslav; Eliáš, Marek (2016). "An Unprecedented Non-canonical Nuclear Genetic Code with All Three Termination Codons Reassigned as Sense Codons". Current Biology. 26 (17): 2364–2369. doi:10.1016/j.cub.2016.06.064. PMID 27593378.
  2. Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 18 November 2016.
This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.